SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4757766|ref|NP_004299.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4757766|ref|NP_004299.1|
Domain Number 1 Region: 237-431
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000575
Further Details:      
 
Domain Number 2 Region: 64-204
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-24
Family CRAL/TRIO domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4757766|ref|NP_004299.1|
Sequence length 439
Comment rho GTPase-activating protein 1 [Homo sapiens]
Sequence
MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTL
PEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHQGELFPSPDPSGL
Download sequence
Identical sequences Q07960
ENSP00000310491 ENSP00000310491 NP_004299.1.87134 NP_004299.1.92137 XP_011518397.1.92137 HR4582 gi|4757766|ref|NP_004299.1| 9606.ENSP00000310491 ENSP00000310491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]