SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47578101|ref|NP_996809.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|47578101|ref|NP_996809.1|
Domain Number - Region: 73-112
Classification Level Classification E-value
Superfamily EF-hand 0.00141
Family Calmodulin-like 0.045
Further Details:      
 
Domain Number - Region: 385-504
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0188
Family UAS domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|47578101|ref|NP_996809.1|
Sequence length 556
Comment selenoprotein N isoform 2 precursor [Homo sapiens]
Sequence
MGRARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAAR
QELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTGSTPAASCEEEELPPDPSEE
TLTIEARFQPLLPETMTKSKDGFLGVSRLALSGLRNWTAAASPSAVFATRHFQPFLPPPG
QELGEPWWIIPSELSMFTGYLSNNRFYPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGA
VACLTAISDFYYTVMFRIHAEFQLSEPPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVP
NHRSLNVDMEWLYGASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGE
PLQFVFEEIKWQQELSWEEAARRLEVAMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWG
ALDDQSCUGSGRTLRETVLESSPILTLLNESFISTWSLVKELEELQNNQENSSHQKLAGL
HLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYM
QFLKEGLRRGLPLLQP
Download sequence
Identical sequences gi|47578101|ref|NP_996809.1| NP_996809.1.87134 NP_996809.1.92137 ENSP00000363434 ENSP00000363434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]