SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4757908|ref|NP_004049.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4757908|ref|NP_004049.1|
Domain Number 1 Region: 22-186
Classification Level Classification E-value
Superfamily EF-hand 1.48e-33
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4757908|ref|NP_004049.1|
Sequence length 189
Comment calcyphosin isoform a [Homo sapiens]
Sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQA
EAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRG
VYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFV
AMMTSAWQL
Download sequence
Identical sequences K7BWI1 Q13938
XP_009432744.1.37143 gi|4757908|ref|NP_004049.1| ENSP00000222125 ENSP00000484912 GO.57407 9606.ENSP00000222125 ENSP00000222125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]