SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4757974|ref|NP_004057.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4757974|ref|NP_004057.1|
Domain Number 1 Region: 20-168
Classification Level Classification E-value
Superfamily EF-hand 7.65e-49
Family Calmodulin-like 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4757974|ref|NP_004057.1|
Sequence length 172
Comment centrin-1 [Homo sapiens]
Sequence
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRAL
GFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Download sequence
Identical sequences A0A140VJG3 Q12798
ENSP00000319052 gi|4757974|ref|NP_004057.1| NP_004057.1.87134 NP_004057.1.92137 ENSP00000319052 9606.ENSP00000319052 ENSP00000319052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]