SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4758502|ref|NP_004123.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4758502|ref|NP_004123.1|
Domain Number 1 Region: 297-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.7e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4758502|ref|NP_004123.1|
Sequence length 560
Comment hyaluronan-binding protein 2 isoform 1 preproprotein [Homo sapiens]
Sequence
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences Q14520
ENSP00000277903 gi|4758502|ref|NP_004123.1| ENSP00000277903 ENSP00000277903 9606.ENSP00000277903 NP_004123.1.87134 NP_004123.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]