SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4758614|ref|NP_004782.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4758614|ref|NP_004782.1|
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number 3 Region: 451-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.035
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  gi|4758614|ref|NP_004782.1|
Domain Number - Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 59-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4758614|ref|NP_004782.1|
Sequence length 494
Comment integrin beta-like protein 1 precursor [Homo sapiens]
Sequence
MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGA
ALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQG
WYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKT
CECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADG
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGSEYP
Download sequence
Identical sequences A0A024RDW7 O95965
9606.ENSP00000365351 NP_004782.1.87134 NP_004782.1.92137 XP_005254157.1.92137 ENSP00000365351 gi|4758614|ref|NP_004782.1| ENSP00000365351 ENSP00000365332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]