SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4759164|ref|NP_004589.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4759164|ref|NP_004589.1|
Domain Number 1 Region: 197-316
Classification Level Classification E-value
Superfamily EF-hand 1.69e-34
Family Osteonectin 0.028
Further Details:      
 
Domain Number 2 Region: 285-380
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-27
Family Thyroglobulin type-1 domain 0.00085
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000036
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4759164|ref|NP_004589.1|
Sequence length 439
Comment testican-1 precursor [Homo sapiens]
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDDDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKG
NVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPC
PCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
WCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV
TEDDEDEDDDKEDEVGYIW
Download sequence
Identical sequences Q08629
ENSP00000282223 NP_004589.1.87134 NP_004589.1.92137 ENSP00000378401 9606.ENSP00000282223 gi|4759164|ref|NP_004589.1| ENSP00000282223 ENSP00000378401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]