SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4759198|ref|NP_004263.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4759198|ref|NP_004263.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-50
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000002
Further Details:      
 
Domain Number 2 Region: 203-341
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000298
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4759198|ref|NP_004263.1|
Sequence length 354
Comment homer protein homolog 1 [Homo sapiens]
Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
Download sequence
Identical sequences K7BY67 Q86YM7
gi|4759198|ref|NP_004263.1| ENSP00000334382 ENSP00000334382 ENSPTRP00000029155 ENSP00000282260 HOMER1 9606.ENSP00000334382 NP_004263.1.87134 NP_004263.1.92137 XP_003822329.1.60992 XP_008974050.1.60992 ENSPTRP00000029155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]