SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47680169|ref|NP_112558.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47680169|ref|NP_112558.2|
Domain Number 1 Region: 209-229,304-424
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-46
Family Pleckstrin-homology domain (PH domain) 0.000000272
Further Details:      
 
Domain Number 2 Region: 110-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.46e-27
Family Protein kinases, catalytic subunit 0.000000414
Further Details:      
 
Domain Number 3 Region: 70-110
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000271
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47680169|ref|NP_112558.2|
Sequence length 429
Comment 3-phosphoinositide-dependent protein kinase 1 isoform 2 [Homo sapiens]
Sequence
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYATRANSFVGTAQ
YVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFP
KARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSE
DDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELD
LQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYV
DPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRY
QSHPDAAVQ
Download sequence
Identical sequences gi|47680169|ref|NP_112558.2| ENSP00000268673 NP_112558.2.87134 NP_112558.2.92137 ENSP00000268673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]