SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47717125|ref|NP_001001132.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47717125|ref|NP_001001132.1|
Domain Number 1 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 3.46e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 8.24e-26
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 1147-1218
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-25
Family SH3-domain 0.0000619
Further Details:      
 
Domain Number 4 Region: 913-975
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 5 Region: 987-1059
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 6 Region: 740-817
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-18
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 7 Region: 1074-1144
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|47717125|ref|NP_001001132.1|
Sequence length 1220
Comment intersectin-1 isoform ITSN-s [Homo sapiens]
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQW
LEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTG
EPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGD
LTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQ
VIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGT
SKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQ
VGLFPSNYVKLTTDMDPSQQ
Download sequence
Identical sequences ENSP00000370691 gi|47717125|ref|NP_001001132.1| NP_001001132.1.87134 NP_001001132.1.92137 ENSP00000370691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]