SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48255891|ref|NP_001001329.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48255891|ref|NP_001001329.1|
Domain Number 1 Region: 396-510
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 208-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000381
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number 3 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|48255891|ref|NP_001001329.1|
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0126
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|48255891|ref|NP_001001329.1|
Sequence length 525
Comment glucosidase 2 subunit beta isoform 2 [Homo sapiens]
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEVQGEQPKPASPAEEDKMPPYDEQT
QAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEY
VYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRL
LCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences ENSP00000465489 ENSP00000466012 ENSP00000395616 ENSP00000465489 ENSP00000466012 NP_001001329.1.87134 NP_001001329.1.92137 NP_001276031.1.87134 NP_001276031.1.92137 XP_011526434.1.92137 gi|48255891|ref|NP_001001329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]