SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48255962|ref|NP_689673.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|48255962|ref|NP_689673.2|
Domain Number - Region: 88-124,201-234
Classification Level Classification E-value
Superfamily RNI-like 0.00235
Family Cyclin A/CDK2-associated p19, Skp2 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|48255962|ref|NP_689673.2|
Sequence length 243
Comment hypothetical protein LOC146723 [Homo sapiens]
Sequence
MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLL
GDHRCLVPFRDLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYS
VCCKVCPNFCACGKENVSGTGQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASH
EECRERSTLGRPQCTGLTPSLAGESPCPRLLPGSPTVRHLIASSCPGLSDPLPLPPGTLP
LGS
Download sequence
Identical sequences Q96MU5
gi|48255962|ref|NP_689673.2| 9606.ENSP00000329353 ENSP00000329353 ENSP00000376396 ENSP00000329353 ENSP00000376396 ENSP00000329353 NP_001289738.1.87134 NP_001289738.1.92137 NP_689673.2.87134 NP_689673.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]