SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4826651|ref|NP_004919.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4826651|ref|NP_004919.1|
Domain Number 1 Region: 15-129
Classification Level Classification E-value
Superfamily L domain-like 2.75e-27
Family Internalin LRR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4826651|ref|NP_004919.1|
Sequence length 256
Comment hypothetical protein LOC755 [Homo sapiens]
Sequence
MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSR
CQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQK
LDNQAVTEEELSRALSEGEEITAAPEREGTGHGGPKLCCTLSSLSSAAETGRDPLDSEEE
ATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILLLLRELDAEGLEAVQQTVG
SRLQALRGEEVQEHAE
Download sequence
Identical sequences O43822
ENSP00000344566 GO.56925 gi|4826651|ref|NP_004919.1| NP_004919.1.87134 NP_004919.1.92137 9606.ENSP00000344566 ENSP00000344566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]