SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4826655|ref|NP_004920.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4826655|ref|NP_004920.1|
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily EF-hand 1.79e-24
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 176-243
Classification Level Classification E-value
Superfamily EF-hand 0.000000000864
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4826655|ref|NP_004920.1|
Sequence length 261
Comment calbindin [Homo sapiens]
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA
LSDGGKLYRTDLALILCAGDN
Download sequence
Identical sequences G1QPC5 G3QQH3 H2PQR9 H2QWE8 P05937
ENSPPYP00000021013 ENSPTRP00000034910 ENSP00000265431 ENSPTRP00000034910 ENSNLEP00000002791 ENSP00000265431 GO.39255 HR3065 W00682 NP_004920.1.87134 NP_004920.1.92137 XP_003268327.1.23891 XP_003821190.1.60992 XP_004047309.1.27298 XP_519852.3.37143 9598.ENSPTRP00000034910 9600.ENSPPYP00000021013 9606.ENSP00000265431 gi|4826655|ref|NP_004920.1| ENSPPYP00000021013 ENSP00000265431 ENSNLEP00000002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]