SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4826870|ref|NP_005004.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4826870|ref|NP_005004.1|
Domain Number 1 Region: 230-322
Classification Level Classification E-value
Superfamily EF-hand 1.59e-18
Family EF-hand modules in multidomain proteins 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4826870|ref|NP_005004.1|
Sequence length 420
Comment nucleobindin-2 precursor [Homo sapiens]
Sequence
MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQ
VIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKA
KLDSLQDIGMDHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKY
EMMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLD
PNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREH
VMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENE
LKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
Download sequence
Identical sequences A0A0D9QXP0 A0A2K5YKY5 G3QSY6 H2Q384 P80303
gi|4826870|ref|NP_005004.1| NP_005004.1.87134 NP_005004.1.92137 XP_003818257.2.60992 XP_008003686.1.81039 XP_008003703.1.81039 XP_008003712.1.81039 XP_008969722.1.60992 XP_008969723.1.60992 XP_008969724.1.60992 XP_008969725.1.60992 XP_008969726.1.60992 XP_008969727.1.60992 XP_008969728.1.60992 XP_008969729.1.60992 XP_009458278.1.37143 XP_009458281.1.37143 XP_011848339.1.47321 XP_016775989.1.37143 XP_016775990.1.37143 XP_016775991.1.37143 XP_016775992.1.37143 XP_016775993.1.37143 XP_016775995.1.37143 XP_016775996.1.37143 XP_016775997.1.37143 XP_016775998.1.37143 XP_016873295.1.92137 XP_016873296.1.92137 XP_016873297.1.92137 XP_016873298.1.92137 XP_016873299.1.92137 XP_016873300.1.92137 XP_016873301.1.92137 XP_016873302.1.92137 XP_016873303.1.92137 XP_016873304.1.92137 XP_016873305.1.92137 XP_016873306.1.92137 XP_016873307.1.92137 XP_016873308.1.92137 XP_018891934.1.27298 XP_018891935.1.27298 XP_018891936.1.27298 XP_018891937.1.27298 XP_018891938.1.27298 XP_018891939.1.27298 XP_018891940.1.27298 XP_018891941.1.27298 XP_018891942.1.27298 XP_018891943.1.27298 XP_018891944.1.27298 ENSGGOP00000005787 ENSP00000436455 ENSP00000481959 ENSPTRP00000005932 ENSPTRP00000005932 ENSGGOP00000005787 9598.ENSPTRP00000005932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]