SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48476342|ref|NP_077008.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48476342|ref|NP_077008.2|
Domain Number 1 Region: 185-458
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.22e-80
Family Mitochondrial carrier 0.0000463
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily EF-hand 2.01e-33
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|48476342|ref|NP_077008.2|
Sequence length 468
Comment calcium-binding mitochondrial carrier protein SCaMC-3 [Homo sapiens]
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Download sequence
Identical sequences K7APP8 Q9BV35
ENSP00000301454 NP_077008.2.87134 NP_077008.2.92137 9606.ENSP00000301454 ENSP00000301454 gi|48476342|ref|NP_077008.2| HR6608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]