SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48762693|ref|NP_001001549.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48762693|ref|NP_001001549.1|
Domain Number 1 Region: 432-545
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Weak hits

Sequence:  gi|48762693|ref|NP_001001549.1|
Domain Number - Region: 309-359
Classification Level Classification E-value
Superfamily PH domain-like 0.000924
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|48762693|ref|NP_001001549.1|
Sequence length 548
Comment growth factor receptor-bound protein 10 isoform b [Homo sapiens]
Sequence
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQEPRHLQLLADLEDSNIFS
LIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQN
YRIPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRS
TRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNP
KAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLK
HHCIRVAL
Download sequence
Identical sequences ENSP00000349818 gi|48762693|ref|NP_001001549.1| NP_001001549.1.87134 NP_001001549.1.92137 ENSP00000349818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]