SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48762697|ref|NP_001001555.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48762697|ref|NP_001001555.1|
Domain Number 1 Region: 420-533
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 105-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 225-357
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000931
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|48762697|ref|NP_001001555.1|
Sequence length 536
Comment growth factor receptor-bound protein 10 isoform c [Homo sapiens]
Sequence
MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHIL
AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGT
SKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMA
SESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLH
VKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPT
DHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLS
PFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL
HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQK
IKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences ENSP00000338543 ENSP00000381790 ENSP00000385046 ENSP00000385189 ENSP00000385366 ENSP00000385748 gi|48762695|ref|NP_001001550.1| gi|48762697|ref|NP_001001555.1| NP_001001550.1.87134 NP_001001550.1.92137 NP_001001555.1.87134 NP_001001555.1.92137 XP_011513618.1.92137 XP_016867534.1.92137 XP_016867552.1.92137 XP_016867553.1.92137 XP_016867554.1.92137 XP_016867555.1.92137 XP_016867556.1.92137 XP_016867557.1.92137 ENSP00000338543 ENSP00000381790 ENSP00000385046 ENSP00000385189 ENSP00000385366 ENSP00000385748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]