SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4885111|ref|NP_005176.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885111|ref|NP_005176.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily EF-hand 8.66e-56
Family Calmodulin-like 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4885111|ref|NP_005176.1|
Sequence length 149
Comment calmodulin-like protein 3 [Homo sapiens]
Sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDG
NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE
EVDEMIRAADTDGDGQVNYEEFVRVLVSK
Download sequence
Identical sequences A0A2I2Z4K8 A0A2I3RIC1 P27482
ENSPTRP00000003821 ENSP00000315299 ENSGGOP00000006566 ENSP00000315299 ENSGGOP00000006566 NP_005176.1.87134 NP_005176.1.92137 XP_003827834.1.60992 XP_003951634.1.37143 XP_004049063.1.27298 9598.ENSPTRP00000003821 9606.ENSP00000315299 gi|4885111|ref|NP_005176.1| ENSPTRP00000003821 ENSP00000315299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]