SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4885365|ref|NP_005307.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885365|ref|NP_005307.1|
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-37
Family TFIIH domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 104-149
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000000392
Family BSD domain 0.0001
Further Details:      
 
Domain Number 3 Region: 185-232
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000929
Family BSD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4885365|ref|NP_005307.1|
Sequence length 548
Comment general transcription factor IIH subunit 1 [Homo sapiens]
Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT
Download sequence
Identical sequences P32780
NP_001135779.1.87134 NP_001135779.1.92137 NP_005307.1.87134 NP_005307.1.92137 XP_006718271.1.92137 gi|214831601|ref|NP_001135779.1| gi|4885365|ref|NP_005307.1| ENSP00000265963 ENSP00000265963 ENSP00000393638 GO.38787 HR3080 IGBMC-0024-000 hsk003002104.2 ENSP00000265963 ENSP00000393638 9606.ENSP00000265963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]