SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4885455|ref|NP_005466.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885455|ref|NP_005466.1|
Domain Number 1 Region: 181-308
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-33
Family Pleckstrin-homology domain (PH domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 343-451
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 7.06e-22
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4885455|ref|NP_005466.1|
Sequence length 575
Comment SH2B adapter protein 3 [Homo sapiens]
Sequence
MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAK
KFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELF
DPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMA
ELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLS
CYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFS
LPHWDSESLPHWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQ
HLEHEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences Q9UQQ2
ENSP00000345492 9606.ENSP00000345492 ENSP00000345492 HR6384 ENSP00000345492 NP_005466.1.87134 NP_005466.1.92137 gi|4885455|ref|NP_005466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]