SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4885549|ref|NP_005456.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885549|ref|NP_005456.1|
Domain Number 1 Region: 144-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-99
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4885549|ref|NP_005456.1|
Sequence length 479
Comment RAC-gamma serine/threonine-protein kinase isoform 1 [Homo sapiens]
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences A0A096MRG7 A0A0P6K622 A0A1U7QFZ6 A0A2I3T9Y4 A0A2K5E2U4 A0A2K5M316 A0A2K6AA78 A0A2K6DSR7 A0A2K6GQN6 A0A2K6PXT7 A0A2K6U3Q1 F1MYJ4 F7CRF1 F7IF11 G3QXL5 G7NWL3 G9BWQ3 H2N390 H9FNA9 I3MFT2 K7WQT1 M3ZB09 Q9Y243 W5P7V7
ENSCJAP00000031436 ENSBTAP00000023654 ENSECAP00000017503 ENSOARP00000006511 ENSPPYP00000000057 ENSGGOP00000007562 ENSMMUP00000026292 9544.ENSMMUP00000026292 9606.ENSP00000263826 9796.ENSECAP00000017503 ENSP00000336943 NP_001178238.1.59421 NP_001178238.1.76553 NP_001243075.1.46622 NP_001253569.1.72884 NP_005456.1.87134 NP_005456.1.92137 XP_001492015.1.31192 XP_003808050.1.60992 XP_003935379.1.74449 XP_004013704.1.66739 XP_004028728.1.27298 XP_004439648.1.5094 XP_004578554.1.84141 XP_004605502.1.94378 XP_004853570.1.39548 XP_005078219.1.91757 XP_005273051.1.92137 XP_005273052.1.92137 XP_005326626.1.77405 XP_005349053.1.66349 XP_005374817.1.28644 XP_005539712.1.63531 XP_005667999.1.46622 XP_005897270.1.15283 XP_005968993.1.78601 XP_006045905.1.26621 XP_006185623.1.101512 XP_006198867.2.17985 XP_007947334.1.48129 XP_007988146.1.81039 XP_008525151.1.77740 XP_008983975.1.60252 XP_008983976.1.60252 XP_009246294.1.23681 XP_010351567.1.97406 XP_010640899.1.5607 XP_010640900.1.5607 XP_010640901.1.5607 XP_010971807.1.22495 XP_010990363.1.51371 XP_011727787.1.29376 XP_011727788.1.29376 XP_011836548.1.47321 XP_011891685.1.92194 XP_011891686.1.92194 XP_011891687.1.92194 XP_011973778.1.54773 XP_012499834.1.63892 XP_012606630.1.48125 XP_012606631.1.48125 XP_012974627.1.91757 XP_013202435.1.66349 XP_013202436.1.66349 XP_014415481.1.101512 XP_016790365.1.37143 XP_017657725.1.79516 XP_017915750.1.57651 XP_019503124.1.44202 XP_019831660.1.53367 XP_020760692.1.74333 XP_020919653.1.46622 XP_021522607.1.9421 ENSPTRP00000050982 ENSP00000263826 ENSP00000355497 ENSMMUP00000037508 ENSNLEP00000004803 ENSP00000263826 ENSP00000355497 ENSP00000479081 ENSPANP00000002368 ENSGGOP00000007562 ENSECAP00000017503 gi|4885549|ref|NP_005456.1| ENSPPYP00000000057 ENSNLEP00000004803 ENSCJAP00000031442 ENSPTRP00000050982 ENSBTAP00000023654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]