SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50083291|ref|NP_775098.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50083291|ref|NP_775098.2|
Domain Number 1 Region: 555-686
Classification Level Classification E-value
Superfamily PH domain-like 5.82e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000609
Further Details:      
 
Domain Number 2 Region: 372-530
Classification Level Classification E-value
Superfamily PH domain-like 4.83e-35
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 3 Region: 283-321
Classification Level Classification E-value
Superfamily WW domain 0.000000000096
Family WW domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50083291|ref|NP_775098.2|
Sequence length 736
Comment amyloid beta A4 precursor protein-binding family B member 2 isoform c [Homo sapiens]
Sequence
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKN
STPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
NLSPTAVINITSEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRG
NHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
DIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEDLHAATVNPDPSL
KEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSV
AVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVW
GVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACS
SLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNK
EDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFEC
HVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVL
SLIDTLKQKRPVTEMP
Download sequence
Identical sequences 9606.ENSP00000295974 NP_775098.2.87134 NP_775098.2.92137 ENSP00000426018 gi|50083291|ref|NP_775098.2| ENSP00000426018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]