SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50301238|ref|NP_000628.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50301238|ref|NP_000628.2|
Domain Number 1 Region: 65-121,148-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.09e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000132
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.36e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50301238|ref|NP_000628.2|
Sequence length 522
Comment glutathione reductase, mitochondrial isoform 1 precursor [Homo sapiens]
Sequence
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences P00390 V9HW90
NP_000628.2.87134 NP_000628.2.92137 ENSP00000221130 9606.ENSP00000221130 ENSP00000221130 gi|50301238|ref|NP_000628.2| ENSP00000221130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]