SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5031689|ref|NP_005804.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031689|ref|NP_005804.1|
Domain Number 1 Region: 578-870
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-79
Family Protein kinases, catalytic subunit 0.0000256
Further Details:      
 
Domain Number 2 Region: 418-532
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-34
Family Pleckstrin-homology domain (PH domain) 0.0000293
Further Details:      
 
Domain Number 3 Region: 130-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5031689|ref|NP_005804.1|
Sequence length 890
Comment serine/threonine-protein kinase D3 [Homo sapiens]
Sequence
MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences G3RL70 H2QHR7 O94806
ENSPTRP00000020330 ENSP00000234179 ENSP00000368356 ENSPTRP00000020330 NP_005804.1.87134 NP_005804.1.92137 XP_004029145.1.27298 XP_005264294.1.92137 XP_008969144.1.60992 XP_014199283.1.60992 XP_016803850.1.37143 XP_016803851.1.37143 XP_016803852.1.37143 XP_018876743.1.27298 ENSGGOP00000016508 ENSGGOP00000016508 gi|5031689|ref|NP_005804.1| ENSP00000234179 ENSP00000234179 ENSP00000368356 NYSGRC-5031689 9598.ENSPTRP00000020330 9606.ENSP00000234179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]