SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5031707|ref|NP_005503.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031707|ref|NP_005503.1|
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily L domain-like 7.94e-45
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 312-576
Classification Level Classification E-value
Superfamily L domain-like 1.79e-42
Family Internalin LRR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5031707|ref|NP_005503.1|
Sequence length 662
Comment leucine-rich repeat-containing protein 32 precursor [Homo sapiens]
Sequence
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQ
LRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGL
GPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDL
HSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQ
AEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSAL
PLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLG
SLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLE
VATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEV
LDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
RFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQY
KA
Download sequence
Identical sequences A0A024R5J7 Q14392
ENSP00000260061 gi|193083139|ref|NP_001122394.1| gi|5031707|ref|NP_005503.1| ENSP00000260061 ENSP00000384126 ENSP00000385766 ENSP00000260061 ENSP00000384126 ENSP00000385766 9606.ENSP00000260061 NP_001122394.1.87134 NP_001122394.1.92137 NP_005503.1.87134 NP_005503.1.92137 XP_005273959.1.92137 XP_011543237.1.92137 XP_016873016.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]