SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5031717|ref|NP_005704.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031717|ref|NP_005704.1|
Domain Number 1 Region: 396-615
Classification Level Classification E-value
Superfamily Bet v1-like 2.61e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-25
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5031717|ref|NP_005704.1|
Sequence length 624
Comment collagen type IV alpha-3-binding protein isoform 1 [Homo sapiens]
Sequence
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDE
TEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESG
YGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQK
YFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKK
KSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFS
SVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHV
VETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPL
NNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKR
EYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences A0A2I3TC89 A0A2J8VTC7 Q9Y5P4
gi|5031717|ref|NP_005704.1| NP_005704.1.87134 NP_005704.1.92137 XP_006714576.1.92137 XP_009447279.1.37143 XP_009447281.1.37143 ENSGGOP00000023416 ENSP00000383996 ENSP00000383996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]