SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5031825|ref|NP_005658.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031825|ref|NP_005658.1|
Domain Number 1 Region: 609-670
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000113
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|5031825|ref|NP_005658.1|
Domain Number - Region: 258-317
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0116
Family Thioltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5031825|ref|NP_005658.1|
Sequence length 685
Comment E3 ubiquitin-protein ligase RNF103 isoform 1 [Homo sapiens]
Sequence
MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYS
GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL
VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT
STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNAEHLKEEWNKSDQYWLKIYLF
ANLDQPPAFFSALSIKFTGRVEFIFVNVENWDNKSYMTDIGIYNMPSYILRTPEGIYRYG
NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL
GTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLLRYSNTTTLASWVRADWMFYSSHPALF
LSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVES
DWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSE
SENTDTLSSEKEVFEDKQSVLHNSPGTASHCDAEACSCANKYCQTSPCERKGRSYGSYNT
NEDMEPDWLTWPADMLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCP
VCRWPSYKKKQPYAQHQPLSNDVPS
Download sequence
Identical sequences O00237
ENSP00000237455 gi|5031825|ref|NP_005658.1| NP_005658.1.87134 NP_005658.1.92137 9606.ENSP00000237455 ENSP00000237455 ENSP00000237455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]