SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032281|ref|NP_000100.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032281|ref|NP_000100.2|
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-79
Family Calponin-homology domain, CH-domain 0.000000611
Further Details:      
 
Domain Number 2 Region: 3077-3200
Classification Level Classification E-value
Superfamily EF-hand 9.08e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3202-3298
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2043-2200
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 991-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 3.28e-23
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 2151-2308
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 3278-3366
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2517-2672
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 9 Region: 1095-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 328-438
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1205-1359
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2744-2870
Classification Level Classification E-value
Superfamily Spectrin repeat 5.97e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2893-3031
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 514-652
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 1511-1666
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1620-1764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000936
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 17 Region: 1815-1959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000022
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 447-548
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000738
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 19 Region: 3039-3076
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 768-923
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000391
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2276-2413
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000225
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 22 Region: 2463-2531
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000575
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|5032281|ref|NP_000100.2|
Domain Number - Region: 908-1000
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000827
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1419-1545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5032281|ref|NP_000100.2|
Sequence length 3677
Comment dystrophin Dp427c isoform [Homo sapiens]
Sequence
MEDEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGS
TRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIM
AGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVC
QQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQVSIEAI
QEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVT
TSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQAQGEI
SNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQMNLLN
SRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLEDLKR
QVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTE
DRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLKA
DLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTAQISQA
VTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDI
TELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQALV
EQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTT
AENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQGPMFLD
ADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLSIPQLS
VTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQSEFEEIEGR
WKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEILKKQL
KQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDHMCQQVYAR
KEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRAKEEAQ
QKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACW
HELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNPNQIRILAQ
TLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF
IDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQIDVAQ
KKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNL
YKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEK
CLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHL
KSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNV
DHITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRGDH
CRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLK
EEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQR
RKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNA
VRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMTED
MPLEISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQS
SGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRR
FHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATGEE
IIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDLNEFVLWLE
EADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQ
DKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLWLSPIR
NQLEIYNQPNQEGPFDVQETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVKRKLEDLSS
EWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLEMPSSLMLE
VPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLE
ELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEA
KEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLL
RDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEA
ETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEG
SDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDEL
SRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEP
RELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDL
KLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQ
LSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPN
KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL
SHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQP
RSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPT
SPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNG
TTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFP
SSRGRNTPGKPMREDTM
Download sequence
Identical sequences NP_000100.2.87134 NP_000100.2.92137 gi|5032281|ref|NP_000100.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]