SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032291|ref|NP_004003.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032291|ref|NP_004003.1|
Domain Number 1 Region: 1741-1864
Classification Level Classification E-value
Superfamily EF-hand 3.75e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 1866-1962
Classification Level Classification E-value
Superfamily EF-hand 4.08e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 707-864
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 815-972
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-22
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1942-2030
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 1181-1342
Classification Level Classification E-value
Superfamily Spectrin repeat 2.13e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 1408-1534
Classification Level Classification E-value
Superfamily Spectrin repeat 3.64e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 8 Region: 1557-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 9 Region: 284-428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000537
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 10 Region: 175-296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000464
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 11 Region: 479-623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 12 Region: 1703-1740
Classification Level Classification E-value
Superfamily WW domain 0.0000000000208
Family WW domain 0.00012
Further Details:      
 
Domain Number 13 Region: 940-1077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 14 Region: 1127-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000158
Family Spectrin repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|5032291|ref|NP_004003.1|
Domain Number - Region: 83-211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0698
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5032291|ref|NP_004003.1|
Sequence length 2341
Comment dystrophin Dp260-2 isoform [Homo sapiens]
Sequence
MSARKLRNLSYKKAVRRQKLLEQSIQSAQETEKSLHLIQESLTFIDKQLAAYIADKVDAA
QMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQIDVAQKKLQDVSMKFRLFQKP
ANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIK
TGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNVLT
EWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSITEVGEALKTVLGK
KETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNVDHITKWIIQADTLLDE
SEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRGDHCRKLVEPQISELNHRF
AAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMNEDNEGTV
KELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKR
QADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAAMA
VEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMTEDMPLEISYVPSTYLTEI
THVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQSSGRIDIIHSKKTAALQ
SATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRRFHYDIKIFNQWLTEAE
QFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATGEEIIQQSSKTDASILQEK
LGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDLNEFVLWLEEADNIASIPLEPGKEQ
QLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQDKLENKLKQTNLQWIK
VSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLWLSPIRNQLEIYNQPNQEGPFD
VQETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVKRKLEDLSSEWKAVNRLLQELRAKQ
PDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTD
WLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNKTSNQ
EARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLE
SWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLLRDYSADDTRKVHMITE
NINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERL
LEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNF
KWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQ
NDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLL
RKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVG
DLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRW
KLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWD
HPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQP
MDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGII
SLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVR
SCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGF
RYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKR
YFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRL
AEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERG
ELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKL
LRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSS
QPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMREDT
M
Download sequence
Identical sequences gi|5032291|ref|NP_004003.1| NP_004003.1.87134 NP_004003.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]