SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032299|ref|NP_004007.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032299|ref|NP_004007.1|
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily EF-hand 1.11e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 142-238
Classification Level Classification E-value
Superfamily EF-hand 7.48e-41
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 218-306
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-22
Family ZZ domain 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|5032299|ref|NP_004007.1|
Domain Number - Region: 427-508
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0183
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5032299|ref|NP_004007.1|
Sequence length 635
Comment dystrophin Dp71b isoform [Homo sapiens]
Sequence
MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL
SHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQP
RSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPT
SPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNG
TTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFP
SSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE
Download sequence
Identical sequences A0A0S2Z3J7 K7AUC3
gi|5032299|ref|NP_004007.1| NP_004007.1.87134 NP_004007.1.92137 XP_008969199.1.60992 XP_009437187.1.37143 XP_016799040.1.37143 XP_018874974.1.27298 ENSP00000367997 ENSP00000367997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]