SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032303|ref|NP_004009.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032303|ref|NP_004009.1|
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily EF-hand 1.05e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 142-238
Classification Level Classification E-value
Superfamily EF-hand 7.14e-41
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 218-306
Classification Level Classification E-value
Superfamily RING/U-box 3.41e-22
Family ZZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5032303|ref|NP_004009.1|
Sequence length 622
Comment dystrophin Dp71ab isoform [Homo sapiens]
Sequence
MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHDDTHSRIEHYA
SRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE
ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAE
AKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRS
DSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHM
ADDLGRAMESLVSVMTDEEGAE
Download sequence
Identical sequences NP_004009.1.87134 NP_004009.1.92137 XP_003317456.1.37143 XP_004064011.1.27298 XP_008969200.1.60992 XP_016799037.1.37143 gi|5032303|ref|NP_004009.1| ENSP00000354464 ENSP00000354464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]