SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50511945|ref|NP_690001.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50511945|ref|NP_690001.3|
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.52e-60
Family Ankyrin repeat 0.0000487
Further Details:      
 
Domain Number 2 Region: 1025-1190
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-48
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 3 Region: 807-877
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.96e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 4 Region: 880-943
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.07e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50511945|ref|NP_690001.3|
Sequence length 1248
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform a [Homo sapiens]
Sequence
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSTVLEEPVQE
DATQETHISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP
MLAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLMDTAVTKKPCSLEIARAPSPRTD
NASEVAVTTPGTSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHR
MNHNQEYFEINTSTGCTSFTASPPASPPTSSVGTTEVKNEGTNHTDDLSRQDDNDPPKEY
DPGQFAGLLHGSSPACESPENPFHLYGKREQCEKGQDEVSLANSPLPFKQSPIENNSEPL
VKKIKPKVVSRTIFHKKSNQLENHTIVGTRSTRSGSRNGDQWVMNAGGFVERACTLGRIR
SLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKGNSERTPSFTSEW
EEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGD
YTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSIT
LREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQM
AQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDP
EDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSST
LPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF
Download sequence
Identical sequences Q7Z6G8
ENSP00000332683 ENSP00000449629 NP_690001.3.87134 NP_690001.3.92137 gi|50511945|ref|NP_690001.3| ENSP00000449629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]