SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50511947|ref|NP_858056.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50511947|ref|NP_858056.2|
Domain Number 1 Region: 275-440
Classification Level Classification E-value
Superfamily PH domain-like 1.24e-48
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 32-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.05e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 106-169
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50511947|ref|NP_858056.2|
Sequence length 510
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform b [Homo sapiens]
Sequence
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMAN
GFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLD
SIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQK
PPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRS
KLERQMAQSSVCEIWTNQNAGFPFSAIHQVHNTGDWGEPSITLRPPNEATASTPVQYWQH
HPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVS
YKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNL
AYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSE
QKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences A0A096MTX1 A0A2I2ZP32 A0A2I3HWN3 A0A2I3SUG5 A0A2J8XMM8 A0A2K5HGA7 A0A2K5MA91 A0A2K5V4Z7 A0A2K5Z571 A0A2K6E9B9 A0A2K6REB7 F6YRP8
ENSP00000448203 NP_858056.2.87134 NP_858056.2.92137 XP_003405332.1.64505 XP_004381317.1.4749 XP_004418056.1.5094 XP_006876001.1.41390 XP_007945380.1.48129 XP_008002546.1.81039 XP_010354242.1.97406 XP_010829885.1.44457 XP_011708717.1.29376 XP_015338375.1.40921 XP_016780433.1.37143 ENSP00000448203 gi|50511947|ref|NP_858056.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]