SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50541961|ref|NP_001002294.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50541961|ref|NP_001002294.1|
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0044
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000035
Family FAD/NAD-linked reductases, N-terminal and central domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50541961|ref|NP_001002294.1|
Sequence length 532
Comment dimethylaniline monooxygenase [N-oxide-forming] 3 [Homo sapiens]
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
Download sequence
Identical sequences A0A024R8Z4 P31513
gi|50541961|ref|NP_001002294.1| gi|50541965|ref|NP_008825.4| ENSP00000356729 ENSP00000356729 ENSP00000375935 NP_001002294.1.87134 NP_001002294.1.92137 NP_008825.4.87134 NP_008825.4.92137 9606.ENSP00000356729 ENSP00000356729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]