SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50593002|ref|NP_003081.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50593002|ref|NP_003081.2|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily L domain-like 2.01e-29
Family U2A'-like 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50593002|ref|NP_003081.2|
Sequence length 255
Comment U2 small nuclear ribonucleoprotein A' [Homo sapiens]
Sequence
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
Download sequence
Identical sequences A0A096NNG4 A0A0D9RWA2 A0A250YDS9 A0A2K5F9R3 A0A2K5ILS4 A0A2K5L6A0 A0A2K5Q7Y2 A0A2K5ZIC3 A0A2K6E958 A0A2K6G8L6 A0A2K6LIN6 A0A2K6QL88 A0A2K6S479 E2QWU2 F7H780 F7IEQ5 G1QI33 G3RZB2 G7P9K0 H0V664 H0XGC9 H2NPC2 H2R145 I3MCU8 M3YHP4 P09661 Q4R8Y8
ENSP00000254193 ENSPPYP00000007744 ENSMPUP00000010851 NP_001247836.1.72884 NP_001270272.1.63531 NP_003081.2.87134 NP_003081.2.92137 XP_002749109.1.60252 XP_002825933.1.23681 XP_003281630.1.23891 XP_003475326.1.53824 XP_003788675.1.62490 XP_003828484.1.60992 XP_003940592.1.74449 XP_004278416.1.21590 XP_004313020.1.83887 XP_004431944.1.5094 XP_004693143.1.23501 XP_004759902.1.14098 XP_005320135.1.77405 XP_007988776.1.81039 XP_008569275.1.73410 XP_010379981.1.97406 XP_011770058.1.29376 XP_011812943.1.43180 XP_011820648.1.47321 XP_011933028.1.92194 XP_012319312.1.9421 XP_012498168.1.63892 XP_012620042.1.48125 XP_014924487.1.86478 XP_015348619.1.40921 XP_017374360.1.71028 XP_017718872.1.44346 XP_018866740.1.27298 XP_019315627.1.44245 XP_020017305.1.5219 XP_510625.2.37143 XP_848923.1.84170 ENSPANP00000014524 ENSOGAP00000015129 ENSPPYP00000007744 5xjc_o 5yzg_o 5z56_o 5z57_o 5z58_o ENSPTRP00000041754 ENSCAFP00000015542 ENSCPOP00000005172 ENSP00000254193 ENSCJAP00000031815 ENSMMUP00000015518 gi|50593002|ref|NP_003081.2| ENSOGAP00000015129 ENSCPOP00000005172 ENSP00000254193 ENSPTRP00000041754 ENSSTOP00000008111 ENSCJAP00000031842 ENSSTOP00000008111 ENSMMUP00000015518 ENSNLEP00000000576 ENSMPUP00000010851 ENSCAFP00000015542 ENSNLEP00000000576 10141.ENSCPOP00000005172 9544.ENSMMUP00000015518 9598.ENSPTRP00000041754 9600.ENSPPYP00000007744 9606.ENSP00000254193 9615.ENSCAFP00000015542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]