SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50658061|ref|NP_055988.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50658061|ref|NP_055988.2|
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 157-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-32
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 3 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.05e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 8.34e-21
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50658061|ref|NP_055988.2|
Sequence length 1168
Comment TBC1 domain family member 1 [Homo sapiens]
Sequence
MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPVRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQMAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSISVDLDSSLSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PIECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKACDSSSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERSALL
QTVEELRRRSAEPSDREPECTQPEPTGD
Download sequence
Identical sequences B9A6J6 Q86TI0
ENSP00000261439 ENSP00000261439 NP_055988.2.87134 NP_055988.2.92137 gi|50658061|ref|NP_055988.2| 9606.ENSP00000261439 ENSP00000261439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]