SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50659098|ref|NP_056245.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50659098|ref|NP_056245.2|
Domain Number 1 Region: 431-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-54
Family Eukaryotic proteases 0.00054
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-32
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 3 Region: 297-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000055
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50659098|ref|NP_056245.2|
Sequence length 737
Comment inactive serine protease PAMR1 isoform a [Homo sapiens]
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKRE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGFVIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSIGSSLHVLFHSDGSKNFDGFHAIYEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEAGKSKIKASEDSLSVLEERNCSDP
GGPVNGYQKITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICI
KACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPMGY
QHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENITAPKTQGLRWP
WQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVV
LGKFYRDDDRDEKTIQSLQISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAA
SRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSV
TDNMFCASWEPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLST
AFTKVLPFKDWIERNMK
Download sequence
Identical sequences NP_056245.2.87134 NP_056245.2.92137 ENSP00000368156 NYSGRC-50659098 ENSP00000278360 9606.ENSP00000278360 ENSP00000482899 gi|50659098|ref|NP_056245.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]