SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50843948|ref|NP_078881.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50843948|ref|NP_078881.3|
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.06e-74
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 397-578
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000000293
Further Details:      
 
Domain Number 3 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 
Domain Number 4 Region: 730-785
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-16
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50843948|ref|NP_078881.3|
Sequence length 786
Comment rho GTPase-activating protein 10 [Homo sapiens]
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEER
KQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKN
HLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATV
ADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL
Download sequence
Identical sequences A1A4S6
9606.ENSP00000336923 NYSGRC-50843948 ENSP00000336923 gi|50843948|ref|NP_078881.3| NP_078881.3.87134 NP_078881.3.92137 ENSP00000336923 ENSP00000336923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]