SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50897266|ref|NP_619650.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50897266|ref|NP_619650.2|
Domain Number 1 Region: 26-174
Classification Level Classification E-value
Superfamily EF-hand 5.08e-41
Family Calmodulin-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50897266|ref|NP_619650.2|
Sequence length 181
Comment calmodulin-like protein 6 [Homo sapiens]
Sequence
MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEW
LMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFD
KEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLI
Q
Download sequence
Identical sequences Q8TD86
HR5514A NP_619650.2.87134 NP_619650.2.92137 ENSP00000304643 9606.ENSP00000304643 ENSP00000304643 ENSP00000304643 gi|50897266|ref|NP_619650.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]