SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51036596|ref|NP_079130.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51036596|ref|NP_079130.2|
Domain Number 1 Region: 13-166,272-397
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.87e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0081
Further Details:      
 
Weak hits

Sequence:  gi|51036596|ref|NP_079130.2|
Domain Number - Region: 127-221
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000712
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51036596|ref|NP_079130.2|
Sequence length 500
Comment pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 [Homo sapiens]
Sequence
MEAARPPPTAGKFVVVGGGIAGVTCAEQLATHFPSEDILLVTASPVIKAVTNFKQISKIL
EEFDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKL
ICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAI
GNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWH
EGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYV
ELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAGDIC
TTSWQLSPVWQQMRLWTQARQMGWYAAKCMAAASSGDSIDMDFSFELFAHVTKFFNYKVV
LLGKYNAQGLGSDHELMLRCTKGREYIKVVMQNGRMMGAVLIGETDLEETFENLILNQMN
LSSYGEDLLDPNIDIEDYFD
Download sequence
Identical sequences Q8WU10
ENSP00000240651 9606.ENSP00000240651 gi|51036596|ref|NP_079130.2| ENSP00000240651 NP_079130.2.87134 NP_079130.2.92137 ENSP00000240651 HR5575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]