SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51243032|ref|NP_001003712.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51243032|ref|NP_001003712.1|
Domain Number 1 Region: 357-747
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.62e-128
Family Oxysterol-binding protein 0.0000346
Further Details:      
 
Domain Number 2 Region: 103-223
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-24
Family Pleckstrin-homology domain (PH domain) 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51243032|ref|NP_001003712.1|
Sequence length 847
Comment oxysterol-binding protein-related protein 8 isoform b [Homo sapiens]
Sequence
MSQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLY
NGSEKDSSTSSKLTKKESLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLK
SWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWA
VKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHD
LSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDES
DNEVMGKSEESDTDTSERQDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEE
NKSLIWTLLKQVRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRL
KKVVKWYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFY
VSNRKDGFCLSGSILAKSKFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGT
MTLELGGTVNITCQKTGYSAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSE
VFITDKKTDNSEVFWNPTPDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEA
TQEKYVLEEAQRQAARDRKTKNEEWSCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEK
DGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRK
KGIELGDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQV
IINFMFK
Download sequence
Identical sequences A0A2J8MJ12
ENSP00000376939 ENSP00000376940 ENSP00000478240 ENSP00000376939 ENSP00000376940 NP_001003712.1.87134 NP_001003712.1.92137 NP_001306581.1.87134 NP_001306581.1.92137 XP_003832933.1.60992 XP_003952295.1.37143 XP_006719287.1.92137 XP_008956603.1.60992 XP_009424153.1.37143 gi|51243032|ref|NP_001003712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]