SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51317373|ref|NP_065980.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51317373|ref|NP_065980.1|
Domain Number 1 Region: 47-318
Classification Level Classification E-value
Superfamily L domain-like 7.48e-57
Family Ngr ectodomain-like 0.001
Further Details:      
 
Domain Number 2 Region: 352-446
Classification Level Classification E-value
Superfamily Immunoglobulin 4.92e-21
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51317373|ref|NP_065980.1|
Sequence length 640
Comment leucine-rich repeat-containing protein 4C precursor [Homo sapiens]
Sequence
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Download sequence
Identical sequences A0A096MRD0 A0A0D9SCY3 A0A2K5H924 A0A2K5L2M8 A0A2K5XNX9 A0A2K6AXG9 A0A2K6JP56 A0A2K6NAM0 F6T8E0 G3QV61 G7PQD6 H2NDN6 H2Q3F7 Q9HCJ2
9544.ENSMMUP00000010422 9598.ENSPTRP00000006103 9600.ENSPPYP00000003841 9606.ENSP00000278198 ENSMMUP00000010422 ENSMMUP00000037102 NYSGRC-IgSF-LRC4C_HUMAN ENSPPYP00000003841 ENSGGOP00000006625 NP_001245348.1.87134 NP_001245348.1.92137 NP_065980.1.87134 NP_065980.1.92137 XP_001114570.1.72884 XP_001155584.1.37143 XP_002821907.1.23681 XP_002821909.1.23681 XP_003831021.1.60992 XP_004051014.1.27298 XP_005578213.1.63531 XP_005578215.1.63531 XP_007999586.1.81039 XP_007999595.1.81039 XP_007999599.1.81039 XP_007999606.1.81039 XP_009458521.1.37143 XP_009458523.1.37143 XP_009458525.1.37143 XP_009458528.1.37143 XP_010374938.1.97406 XP_010374939.1.97406 XP_010374940.1.97406 XP_011518540.1.92137 XP_011518541.1.92137 XP_011518542.1.92137 XP_011518543.1.92137 XP_011518544.1.92137 XP_011518545.1.92137 XP_011518546.1.92137 XP_011722432.1.29376 XP_011722433.1.29376 XP_011722434.1.29376 XP_011722435.1.29376 XP_011722436.1.29376 XP_011722437.1.29376 XP_011722438.1.29376 XP_011722440.1.29376 XP_011722441.1.29376 XP_011722442.1.29376 XP_011722443.1.29376 XP_011722444.1.29376 XP_011796134.1.43180 XP_011796136.1.43180 XP_011796137.1.43180 XP_011796138.1.43180 XP_011796139.1.43180 XP_011828834.1.47321 XP_011828835.1.47321 XP_011828836.1.47321 XP_011828837.1.47321 XP_011828838.1.47321 XP_011917685.1.92194 XP_011917686.1.92194 XP_011917687.1.92194 XP_011917688.1.92194 XP_011917689.1.92194 XP_011917690.1.92194 XP_011917691.1.92194 XP_011917693.1.92194 XP_011917694.1.92194 XP_011917695.1.92194 XP_011917696.1.92194 XP_014202264.1.60992 XP_014202265.1.60992 XP_014202266.1.60992 XP_014202267.1.60992 XP_014969913.1.72884 XP_014969914.1.72884 XP_014969915.1.72884 XP_014969916.1.72884 XP_014969917.1.72884 XP_014969918.1.72884 XP_014969919.1.72884 XP_014969920.1.72884 XP_014969921.1.72884 XP_014969922.1.72884 XP_014969923.1.72884 XP_014969924.1.72884 XP_015290378.1.63531 XP_015290379.1.63531 XP_015290380.1.63531 XP_015290381.1.63531 XP_015290382.1.63531 XP_015290383.1.63531 XP_015290384.1.63531 XP_015290385.1.63531 XP_015290386.1.63531 XP_015290387.1.63531 XP_015290388.1.63531 XP_015290389.1.63531 XP_015290390.1.63531 XP_015290391.1.63531 XP_016776186.1.37143 XP_016776187.1.37143 XP_016776188.1.37143 XP_016776190.1.37143 XP_016776191.1.37143 XP_016776192.1.37143 XP_016776193.1.37143 XP_016776194.1.37143 XP_016776195.1.37143 XP_016873559.1.92137 XP_016873560.1.92137 XP_016873561.1.92137 XP_016873562.1.92137 XP_016873563.1.92137 XP_016873564.1.92137 XP_016873565.1.92137 XP_016873566.1.92137 XP_016873567.1.92137 XP_016873568.1.92137 XP_017724302.1.44346 XP_017724306.1.44346 XP_508374.1.37143 ENSP00000278198 ENSP00000434761 ENSP00000436976 ENSP00000437132 ENSP00000480903 ENSGGOP00000006625 ENSMMUP00000010422 ENSPTRP00000006103 ENSP00000278198 ENSPTRP00000006103 ENSPANP00000002329 ENSP00000278198 ENSP00000434761 ENSP00000436976 ENSP00000437132 ENSPPYP00000003841 gi|51317373|ref|NP_065980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]