SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51464364|ref|XP_373042.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51464364|ref|XP_373042.2|
Domain Number 1 Region: 231-370
Classification Level Classification E-value
Superfamily EF-hand 6.04e-38
Family Calmodulin-like 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51464364|ref|XP_373042.2|
Sequence length 377
Comment PREDICTED: hypothetical protein LOC391722 [Homo sapiens]
Sequence
MRWSRGEGGERVLLLQGLSQGTQWHQNSGHLGSANSWEGSPGRSGAGKKSRRSGASEYCE
HLQCGDHVHLIGVYGAQCQAGPKCRFRKGVSGCRSRLMRAEVDRPSACSPPLSCRPALHY
FAFREQRNVNKNRNMAPVSSASSPPSQNCCCKLVVLRNDEKPVVFPKFQESEADSRRVKM
PRAPRCRLSSRTGWFRFWYLVPELSNHHVEQKGKTTKKRPQCATSKVFATFDQSQIQEFK
EAFNMIDQNRDGFISKEDLHGMLASLGKNPTDACLDAVMNEAPGPINFTMLLAMFGKKLN
GTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTVGDQFTDEEVDELYTEAPIDKKGNFN
YIEFTSILKHGVKDKDD
Download sequence
Identical sequences gi|51464364|ref|XP_373042.2| NYSGRC-51464364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]