SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51510891|ref|NP_001003936.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51510891|ref|NP_001003936.1|
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.59e-21
Family Thioltransferase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51510891|ref|NP_001003936.1|
Sequence length 115
Comment thioredoxin domain-containing protein 8 [Homo sapiens]
Sequence
MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVN
NSPELAETCHIKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLCLADDGNE
Download sequence
Identical sequences gi|51510891|ref|NP_001003936.1| NP_001003936.1.87134 NP_001003936.1.92137 ENSP00000363634 ENSP00000363634 9606.ENSP00000363634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]