SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51558748|ref|NP_001003677.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|51558748|ref|NP_001003677.1|
Domain Number - Region: 79-143
Classification Level Classification E-value
Superfamily EF-hand 0.0347
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51558748|ref|NP_001003677.1|
Sequence length 337
Comment hypothetical protein LOC79096 isoform 2 [Homo sapiens]
Sequence
MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHI
LFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKA
ARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSG
QHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLM
ALSKHRGINQALGALPDKGDLMHDPAMDEELERLLLPFFRLAQVPGLVNSVTASPEASCL
PSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
Download sequence
Identical sequences ENSP00000367878 HR2337 NP_001003677.1.87134 NP_001003677.1.92137 ENSP00000367881 gi|51558748|ref|NP_001003677.1| ENSP00000367878 9606.ENSP00000367878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]