SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5174661|ref|NP_005969.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5174661|ref|NP_005969.1|
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily EF-hand 1.11e-22
Family S100 proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5174661|ref|NP_005969.1|
Sequence length 97
Comment protein S100-A2 [Homo sapiens]
Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMG
SLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Download sequence
Identical sequences NP_005969.1.87134 NP_005969.1.92137 ENSP00000357697 ENSP00000357698 ENSP00000357699 ENSP00000473260 gi|5174661|ref|NP_005969.1| ENSP00000357697 ENSP00000357698 ENSP00000357699 ENSP00000473260 9606.ENSP00000357697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]