SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51944950|ref|NP_689614.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51944950|ref|NP_689614.2|
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.54e-49
Family Phosducin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51944950|ref|NP_689614.2|
Sequence length 241
Comment phosducin-like protein 2 [Homo sapiens]
Sequence
MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDE
FDEEDMQAVETYRKKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRS
SIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGII
ECGGINLKLEELEWKLAEVGAIQTDLEENPRKDMVDMMVSSIRNTSIHDDSDSSNSDNDT
K
Download sequence
Identical sequences Q8N4E4
9606.ENSP00000295645 ENSP00000295645 ENSP00000295645 gi|51944950|ref|NP_689614.2| ENSP00000295645 NP_689614.2.87134 NP_689614.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]