SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52138725|ref|NP_001004432.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52138725|ref|NP_001004432.1|
Domain Number 1 Region: 35-369
Classification Level Classification E-value
Superfamily L domain-like 6.19e-61
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 419-503
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52138725|ref|NP_001004432.1|
Sequence length 593
Comment leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 precursor [Homo sapiens]
Sequence
MDAATAPKQAWPPWPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPL
DTELLDLSGNRLWGLQQGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRL
RIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLA
KLSTLTLERCNLSTVPGLALARLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWPS
LEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPLV
RLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPL
TCDCRLLWLLRLRRHLDFGMSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPALIRKSGP
RWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDRG
AYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGF
LPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF
Download sequence
Identical sequences Q6UY18
NP_001004432.1.87134 NP_001004432.1.92137 ENSP00000357810 ENSP00000357810 NYSGRC-IgSF-LIGO4_HUMAN ENSP00000357810 9606.ENSP00000357810 gi|52138725|ref|NP_001004432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]