SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52353306|ref|NP_001005210.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52353306|ref|NP_001005210.1|
Domain Number 1 Region: 78-257
Classification Level Classification E-value
Superfamily L domain-like 2.38e-37
Family Ngr ectodomain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|52353306|ref|NP_001005210.1|
Sequence length 341
Comment leucine-rich repeat-containing protein 55 [Homo sapiens]
Sequence
MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPA
MLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRI
TAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAH
GLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNP
WVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDD
YLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
Download sequence
Identical sequences ENSP00000419542 9606.ENSP00000330864 ENSP00000419542 ENSP00000419542 NP_001005210.1.87134 NP_001005210.1.92137 gi|52353306|ref|NP_001005210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]